DPCstruct | MC28357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 382 ± 42 aa |
| Standard deviation of domain lengths | 41.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2SP94 | 13-366 | TGAYALFKSVLEANQARFNSELFLYQTPSNQWVESDIYRYADMFVAAKIMHEEGVAGSKLFVGDARPNGHVYGLVNFAAFLAQSMKE… |
| A0A4U2EG63 | 668-1065 | EGPLTIIDSLNRELANAEYVMDNEAFLFETPQSQWIPSTVYKWADFLDGLNAMHNIGVAGNKFWLLDENEDDATNSKYAKVAIAAFL… |
| K0S0P1 | 475-845 | None |
| K0S5Q3 | 384-761 | None |
| K0SDI1 | 146-539 | None |
| K0SE72 | 112-464 | None |
| K0SL48 | 10-360 | None |
| B8LE24 | 862-1224 | None |
| B8BYD8 | 220-587 | None |
| B8C4V5 | 537-952 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.