DPCstruct | MC28356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 248 ± 23 aa |
| Standard deviation of domain lengths | 22.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05591- PF05943 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2Y043 | 198-410 | GDFTGRSARGLIEVGDALASRKPILLDPDTVEDVIEGFATTLVLPIGKDGAGVEVKLGGLDDLHPDELYENVELFSALRDLKSQLSH… |
| A0A349ECX8 | 36-274 | MPGRMEFQFNLPKSDSHPVRCDPAAPLRLLIMADFSGRAHREMPGPLSDLASRPLLTVDVDTLDAVMARLAPKLRLAGPEPGSILTL… |
| A0A2G6Q4A4 | 6-221 | None |
| A0A7X7E510 | 1-281 | None |
| A0A2V9Y0I8 | 1-245 | None |
| B4D022 | 1-252 | None |
| A0A7C2QEH0 | 158-435 | None |
| A0A1I5KIT3 | 347-615 | None |
| A0A4Q4XFS5 | 37-267 | None |
| A0A518B632 | 2-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.