DPCstruct | MC28355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 226 ± 23 aa |
| Standard deviation of domain lengths | 23.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4FYD3 | 1-190 | MDFGDDSSRWANDEQCDDPRFSGEGMAPVLERADLWSDASDCQAAFAAGTITYIGEEPELPPVEFDYGDDWSEWANDGECDDPRFTG… |
| A0A349E9M9 | 8-219 | LNHAKIISIGLLLLGLASNSLAQTNVSSIDFGDDGSSWANDQECDDPRFGGDGMASTLVEADQLHDASDCRTLFLAGSIYLLDGNSN… |
| A0A399RIN1 | 419-667 | None |
| A0A3B0ULP0 | 309-525 | None |
| A0A2E7HK39 | 55-318 | None |
| A0A2R8AD74 | 6-232 | None |
| A0A7C5C9L2 | 1-227 | None |
| A0A0N4Z8Y6 | 739-966 | None |
| A0A2D9RBA7 | 1-253 | None |
| A0A2D8YE86 | 281-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.