DPCstruct | MC2835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 180 ± 16 aa |
| Standard deviation of domain lengths | 16.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.44 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | PF07364- PF07171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836CFF6 | 420-611 | ARVAAGGDTPPILLADISDNPGGGARGNTTWMLRALHEARIPGVVLGLFTDEALAETARQAGVGVRFDAIFNAVESEFARRFETGVT… |
| A0A2E0E5H8 | 183-360 | ELSQKTTRPVIIADPQDNPGAGASGDSTGLLSQLIQSKVPALVGMFWDPNAANHCHTVGLGKTITIDIGGKFPRENGPALTITGVIK… |
| A0A4V2D886 | 81-248 | None |
| A0A1F3SGX6 | 44-226 | None |
| R8BHQ3 | 637-816 | None |
| A0A3M1D9S7 | 447-637 | None |
| A0A4P5SSF6 | 291-483 | None |
| N9QFN0 | 164-363 | None |
| A0A7S2CYI1 | 6-187 | None |
| A0A3D8SX90 | 525-714 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.