DPCstruct | MC28349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1601 |
|---|---|
| Mean domain length (aa) | 142 ± 28 aa |
| Standard deviation of domain lengths | 28.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.22 |
| Pfam Score | 93.15 |
| Assigned Pfam label(s) | CL0063- CL0057- CL0104- CL0123- PF01329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839QXI7 | 46-179 | LHMRYDLISAGELVRIDHFNQVTPDVPRGRKYLEELGFRVTEDIKDEAGTTYAAWMHRKGTVHDTALTGGDGPRLHHIAFATHEKHN… |
| A0A543QWB2 | 12-155 | SSLFADIRGHHIAIRVPDRDVAIKWYQDKLDWRVVYMWAYGDQQLAFLAPPNDDRFMVELLAGGDPSPHPLPPYKDLADSLRYAGYH… |
| A0A1I2P5N2 | 2-109 | None |
| A0A2D9Q2J8 | 41-152 | None |
| A0A1H9F6T2 | 2-138 | None |
| A0A291QN97 | 54-249 | None |
| A0A424L3L2 | 4-146 | None |
| A0A3R7RR85 | 2-114 | None |
| A0A557R1U3 | 2-144 | None |
| A0A6J7S7T4 | 2-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.