DPCstruct | MC28348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 52.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7W122 | 1-58 | MGMFSRMAEQKIVEAMAKGEFDNLAGAGKPLVIEDLSHVPEELRMSYKILKNANILPE |
| W6MC38 | 1-61 | MNLLDHIAEARIQEAIDRGELRGLAGEGQPLRLEDDSAIPEELRVAYRLLKNAGFLPPELQ |
| A0A536ZS79 | 1-58 | None |
| A0A1V4QJI9 | 1-61 | None |
| A0A2V8MER3 | 9-66 | None |
| A0A423PT50 | 1-58 | None |
| A0A2X2T414 | 1-61 | None |
| A0A179D1U6 | 1-77 | None |
| A0A1S9TA43 | 1-61 | None |
| A0A3N5FJR6 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.