DPCstruct | MC28347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 5.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855ELF4 | 8-68 | IFPDDWSRTQVLKTIEETYENARFQTGSSNAYIGVTSNGMKIRIFLTPNRKIISVFPIYKR |
| A0A2V3W6W4 | 120-175 | FPKDWDTQQVVDAINEAYESKEFISGNTYEGLTKEGMVIRMYVDEQEKIISAFPIY |
| A0A414HRS4 | 67-125 | None |
| A0A6L3B8U6 | 39-94 | None |
| A0A0G8FB37 | 378-434 | None |
| A0A7U9GIB6 | 264-321 | None |
| A0A1A5XKH3 | 277-333 | None |
| A0A150K7Y4 | 227-282 | None |
| A0A2U8QUR2 | 122-183 | None |
| A0A0M4FL20 | 154-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.