DPCstruct | MC28344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 2.88 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 48.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5XBR2 | 1-61 | MSNSNFYCERKWCETCKEYVPYLMSTDHSFCVKCHSKVRIFSREDSIRFHDTIQRHKWQAS |
| A0A2A5DE06 | 17-75 | MPLSDFFKDSKYCPRCHDYVRYLQSLDASFCIDCGGKVRLFSAADKRAFLRDLQQAKEA |
| A0A2D5AXF6 | 1-55 | None |
| A0A2D5NKF3 | 32-91 | None |
| A0A521H8J1 | 1-57 | None |
| A0A7C1T2K5 | 13-73 | None |
| A0A518F100 | 1-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.