DPCstruct | MC28341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 193 ± 39 aa |
| Standard deviation of domain lengths | 39.08 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834TD72 | 9-181 | ASKLKDITKDAVSRIAILKKQRQVRGSYAHSDVVQLLNLGYHDRALLRVEQLIRENNMLDVFVMIENYFNFLRQKAELLEKNKECPQ… |
| A0A1Z5JZ08 | 8-200 | AKKLKPELKMAVGRIQIASNKKAALQKQNLREVAKMLAEDPPKEEKARIRAEALIRDDYLIEAYEILQLNCELLYERMKLIEYSKDC… |
| A0A7J6PKP5 | 13-239 | None |
| A0A835ISK4 | 16-252 | None |
| F8NEX6 | 4-164 | None |
| A0A7S1QU16 | 2-154 | None |
| A0A0B7MV08 | 3-233 | None |
| A0A7N2KWL5 | 12-241 | None |
| D7KIL6 | 13-241 | None |
| A0A444XUT3 | 15-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.