DPCstruct | MC2834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 437 ± 55 aa |
| Standard deviation of domain lengths | 54.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 94.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07364- PF07171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0Z3X7 | 33-493 | LVRGPEILGLEGTGTVYGGAVARARQLEVELVPTTYGSVMPGGRVTREAFDRLRDEILAGVRAALPVDGVLLVLHGAMALEDHDDAE… |
| A0A836CFF6 | 150-628 | KANRFAPVTVRADFEKECWAEGEAISRGAYASSHLPLEIPGFYRRMDETGPWVPVPIILAAAQPGGPIVQAVFDEFMDKALTGLAAA… |
| R8BHQ3 | 368-846 | None |
| A0A3M1D9S7 | 171-637 | None |
| A0A4P5SSF6 | 30-500 | None |
| A0A3D5FKV6 | 116-570 | None |
| N9QFN0 | 6-373 | None |
| A0A446C915 | 502-969 | None |
| A0A4R9EU57 | 394-842 | None |
| A0A075H745 | 6-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.