DPCstruct | MC28337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 221 ± 30 aa |
| Standard deviation of domain lengths | 30.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z5JL03 | 3-259 | ITHQNTSNLLEVIPSSKRTPAQVSWWCTAGDESPTYRLLRKPVNLQELNKFERPYSIWRDNETLAYVIPHNKSDFPDDERNSLQITY… |
| A0A1Z5JMY6 | 2-208 | SKSNAPPLLALIPPTDLEPHQIATTKEGVPLPTHTFLRPLRTIDELMVYENGAIVWMEEYETLVVIYRRYNTFGPLDIKYLKFFQLY… |
| A0A1Z5JP86 | 19-255 | None |
| A0A1Z5JRZ6 | 47-236 | None |
| A0A1Z5JUE8 | 26-229 | None |
| A0A1Z5JY55 | 2-225 | None |
| A0A1Z5JUT3 | 3-239 | None |
| A0A1Z5JV51 | 34-271 | None |
| A0A1Z5JXU4 | 2-184 | None |
| A0A1Z5JJD0 | 143-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.