DPCstruct | MC28334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1IWD5 | 15-76 | WDAYDWDSLPQGYKQHWEVLGFNRASWNGNIPEPRTLSTAWSQLSPAERNSATALGYNQRMW |
| A0A1Z5JJJ1 | 1-66 | MTKYNDCTWKDLPEDAKKAAKVLGYKKKTWDEDLEVAVDDKEWDELTDEQQEAAKVLGYTEESWNA |
| A0A7X7WSR5 | 8-76 | None |
| G2E1Q7 | 31-128 | None |
| A0A448ZEH6 | 6-69 | None |
| A0A1E7F3A4 | 44-112 | None |
| A0A1E7F3K3 | 4-68 | None |
| K0R4T0 | 188-263 | None |
| K0RY11 | 3-75 | None |
| A0A7S0BUP7 | 227-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.