DPCstruct | MC2833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 510 ± 81 aa |
| Standard deviation of domain lengths | 81.45 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.36 |
| Pfam Score | 92.74 |
| Assigned Pfam label(s) | PF05278- CL0063- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068MW83 | 2-436 | ILVVGATGGVGKRVVKLLVDGGQEVRVLVRDVPRAQKIFQTWFDGPLPDRLEFFGGDLTIKESLTPALMGRVTAVICCSGTKVQPVE… |
| A0A836CBF4 | 1-546 | MRILLLLSLAACQSFVVPNTVGIRGGSGLRSNSARMAVAAPQTGNAFKWLTDIFSFSKASVPKDAVLVIGASGRAGREVVKELLASG… |
| A0A5B8MVB6 | 5-621 | None |
| A0A7Y0IVF8 | 2-370 | None |
| A0A0E0AE27 | 80-652 | None |
| K9RQY4 | 1-510 | None |
| A0A1R3I0U0 | 281-815 | None |
| A0A7J7IG19 | 1-479 | None |
| A0A383W9U5 | 337-901 | None |
| A0A7J7CZE5 | 8-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.