DPCstruct | MC28327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 128 ± 20 aa |
| Standard deviation of domain lengths | 19.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A259Y6V2 | 28-142 | ADSDAESERLKFGSVEQFVREHLAVLYRREVEDVPHRCWCPQWWRHAEAVARLEALWRSFEHLRTDPHTGMSVWLRDHADHHMEKLF… |
| A0A109ILD2 | 16-112 | LSNWVRLLLVPVYAREVSSAAPWCGQWWRHPEAVAQLHGLWLAWQELTGPDAGLCGPANWHRDYLEPVLNSLRNPAGPFAGCKVGAH… |
| A0A345K3Q4 | 56-198 | None |
| Q47LN0 | 27-163 | None |
| A0A1R4IZ10 | 103-229 | None |
| A0A365ZG28 | 4-127 | None |
| A0A3N9XZH9 | 2-101 | None |
| A0A260MF07 | 62-191 | None |
| A0A4Q5JAL7 | 47-171 | None |
| A0A5C4XUE1 | 68-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.