DPCstruct | MC28325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 285 ± 35 aa |
| Standard deviation of domain lengths | 35.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A649Z050 | 13-363 | TQSIDELIAAYERVTTFDYGSLVEHGQNILDDLGYSIPTDGRQKIADRINSNEKINRIINAQKWSEKKKREVLEKLPTMIAPYDVYR… |
| A0A3S9AX93 | 3-219 | YLEHHDKLQKWVVRELERTRQAGTIKAEIKGGAQAKKMMQEATRGYPASWMKAANEYGKLNVKYSTDRGWAYTSQKAETVRLPKFGL… |
| A0A2X2RN71 | 79-427 | None |
| A0A2Z4VZY4 | 49-288 | None |
| A0A2D7EXE0 | 606-928 | None |
| A0A7K1WBL9 | 73-318 | None |
| A0A661PRA5 | 703-998 | None |
| A0A1E7YRV0 | 23-314 | None |
| A0A2N3RQS7 | 242-535 | None |
| A0A2X3K2L1 | 280-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.