DPCstruct | MC28324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Standard deviation of domain lengths | 14.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3YMJ5 | 93-208 | GVEHQGFLSAVTYQGSVTLWETVETQAGRVYELWDSYGLAHDLLAPILAAGLATGHQVVACPDPMAPQRLAHLIFPDLSLAFVTSNA… |
| A0A1C6BAZ6 | 4-113 | LPKIQYFLGANSPTGFYSLYPELIQPERARTIYILKGGPGCGKSTLMRRVGARMEEEGLDTEYILCSGDPDSLDALLLPQLGVALVD… |
| A0A7V6M949 | 1-125 | None |
| A0A3B8HZH0 | 4-114 | None |
| R5IEV0 | 3-119 | None |
| A0A7C6J2V5 | 6-117 | None |
| A0A174MRJ7 | 5-128 | None |
| A0A7X8UAU5 | 134-264 | None |
| A0A2A2IH90 | 168-302 | None |
| A0A6N8BU81 | 3-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.