DPCstruct | MC28320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 194 ± 32 aa |
| Standard deviation of domain lengths | 31.84 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 29.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00921 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218PFC5 | 66-276 | VDTFITNTLDKIADGAKTAAKGATGDVIGNATATGHGATPASKDSVVSLVKGIKTIVEVVLKKDEGNAGATKTGDDKKDVGKLFADD… |
| Q8GRD1 | 15-196 | DASPADATSVNALVKGIKEIVGVVLKKDEGNPEATKTKDDQQKTIGNLFEKKESGTDAEAAAASASIGVVSGADILQAIAKSSETAD… |
| A0A1L4DG90 | 999-1202 | None |
| A0A1L4DG77 | 39-200 | None |
| A0A218PFC7 | 1-222 | None |
| A0A7U3YB06 | 1-154 | None |
| A0A218PF20 | 223-433 | None |
| A0A142JDL6 | 36-274 | None |
| W5SC34 | 25-241 | None |
| W5SGI2 | 11-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.