DPCstruct | MC2832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 258 ± 50 aa |
| Standard deviation of domain lengths | 50.47 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3Q9H3 | 15-213 | TDLKTKFEEEIGNLQMLSDQFQSKISSLEQQCNNDKREYLNVLHKLHEQNADAMDKLKQLDNTMQTVSTKVVHLGDQLESVHLPRAR… |
| A0A836C6X2 | 1-285 | MPDPGSSSKPQAAADDADDGIDAEVAALIRSGPFETMILDTPPSEFDTAKLVEALTSPYIADDGAGGVALDPHALKKLFSTVSAMLS… |
| A0A4C1TNQ7 | 30-228 | None |
| A0A3P6VF58 | 1-183 | None |
| A0A0V0X822 | 33-237 | None |
| A0A817HWN8 | 17-243 | None |
| A0A0G2GHI8 | 281-586 | None |
| A0A445EHI7 | 6-307 | None |
| C1MNS4 | 1-344 | None |
| A0A183MNC4 | 11-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.