DPCstruct | MC28317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 95 ± 22 aa |
| Standard deviation of domain lengths | 21.82 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0SZI6 | 1-138 | MSTEEPSKCCVCGEGTTKRCQACAKHGIHLFFCSPEHQKLVWKHHKQVCGPNAHPLSPPACSDDELRDLLAHGRHPRALPAGTLGCV… |
| A0A5C5G292 | 115-207 | KTCLVCGTKTRNRCSDCAKAGIDLFFCSHEHQKLVWKAHRLVCGPGKANPFMWPLLTEDESREVLAHMHESTADLGESTVAHAVETL… |
| G0SZ58 | 7-102 | None |
| A0A4U0VTG4 | 9-109 | None |
| M7WL09 | 1-87 | None |
| M7WEC7 | 7-102 | None |
| A0A2S5BBV4 | 8-81 | None |
| A0A5C5G0T1 | 3-130 | None |
| G0SZF1 | 31-118 | None |
| A0A061BM48 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.