DPCstruct | MC28312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 247 ± 48 aa |
| Standard deviation of domain lengths | 48.02 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.57 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | CL0292- CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W0EFK7 | 9-258 | LREGVEISIILAIILAYLKQLGASRASGKVWLGTAAAALVSLLTGVVIFFVLGKTEMGDFQEILEGTFMLVAVVILTWMTLWMKRQS… |
| X1GWV8 | 31-214 | KTIEKMEQSIERQKAFSISLLTFIIIIREGIELVLLLTGTASIGSINQTTIGIGSIIGIGISVIIGLLTFYGIKSIDLSKFFKATNL… |
| A0A6N2TE07 | 449-706 | None |
| L0D920 | 468-728 | None |
| A0A135V4C3 | 1-175 | None |
| A0A812PBX1 | 79-388 | None |
| K0ZHA6 | 500-747 | None |
| C4LLP3 | 1-199 | None |
| A0A353FFX2 | 196-442 | None |
| A0A538TGT8 | 1-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.