DPCstruct | MC28311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 91 ± 5 aa |
| Standard deviation of domain lengths | 5.29 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D3K7Y1 | 1-79 | MKLLTFHHTDNGNCRVYYKDSMKQLVCFQPSHLKGQFGLLACSRDGEPSHNIEVSGYIIDRFPTASDGATAVQFRTWYL |
| A0A7Y1AD36 | 1-92 | MKLIKLSRIDNDNCRVYYREAENRLLCYQQAMRGTYELFVCSRDGEPSHAIDQKTHKIDAFPSTKCATAIGFQSWYLKERLFGFMCV… |
| A0A3R9BJD2 | 56-144 | None |
| A0A1P9YE46 | 1-92 | None |
| A0A1E5X7F6 | 165-255 | None |
| R0CNI7 | 321-410 | None |
| A0A2L0T6Q0 | 16-109 | None |
| A0A849HNQ4 | 87-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.