DPCstruct | MC28310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1Y8A1 | 13-75 | AIDPPYKPRKKRQQVKNACVNCQKACKKCDEGRPCSRCIKYGLTDTCVDSPRKARKKGVKRGP |
| A0A1X2HT39 | 1-73 | MPFNAKAEDDVKASDPQTPLPKTRSKYVKNACTNCRKASRKCDDARPCPRCIKYALEDSCVSYVRRKRPEKKN |
| A0A5E3XLV0 | 72-140 | None |
| A0A4Y7QJB0 | 74-157 | None |
| A0A1X2INA6 | 3-77 | None |
| A0A0H2RNM4 | 72-165 | None |
| A0A4P9Y2E5 | 586-665 | None |
| A0A168JLK8 | 48-119 | None |
| A0A077X0N0 | 46-126 | None |
| A0A1X0RY65 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.