DPCstruct | MC2831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 355 ± 84 aa |
| Standard deviation of domain lengths | 83.68 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05226 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2JCU0 | 171-571 | IPVISLSVTIFVLLLRWSGLLQGLEWSMLDQFFRWRSLEPSDPRIAIVTIDERDLTEVGKWPIPDSILAKTITNIKAQNPQGIGLDL… |
| A0A654SKA8 | 28-344 | SIPDYKLAELLHKLQQYQPRVIGLDLYRDSQDPKQPNQRNLVDELKADTVVVVCKGKDHKFDPQGVKPPEQVPVERQGFTDGIEDSD… |
| A0A6M0EQU9 | 20-377 | None |
| A0A532E8V4 | 10-324 | None |
| A0A6M0G4N1 | 220-626 | None |
| A0A1W9X818 | 10-280 | None |
| A0A661AQT9 | 26-396 | None |
| V5V5T3 | 22-398 | None |
| L8M040 | 164-555 | None |
| A0A433VZ04 | 22-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.