DPCstruct | MC28307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 203 ± 17 aa |
| Standard deviation of domain lengths | 17.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.97 |
| Pfam Score | 89.29 |
| Assigned Pfam label(s) | PF12247- PF12246 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5BZY0 | 295-487 | ALLTSVFHNSWQKTRVMTHFWYDSNPKNFISPNATQTTSLVERVINWNVPSSIVEDELRRQSSSTIDFALCLGATSTDKLASRTRTK… |
| A0A1X2HAQ4 | 8-227 | PLHQFYQSRKVASYFWFDPATEHIMHHHQDYNHTHSGSSNFSPKGNASPLNTVYDATRSWHVTHDFLDAEKKAQKTDVVDIAFCIKA… |
| A0A4Q1B8A0 | 212-440 | None |
| A0A0F8X2J2 | 380-567 | None |
| A0A395IGF8 | 31-200 | None |
| A0A397TDM2 | 1-200 | None |
| A0A177TXI9 | 569-795 | None |
| A0A2G4SP67 | 48-254 | None |
| A0A1X2IY74 | 53-247 | None |
| A0A4P9XTP6 | 367-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.