DPCstruct | MC28306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 231 ± 24 aa |
| Standard deviation of domain lengths | 23.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4W6S1 | 2-245 | LIRQALRDRAFPALGTNHPCRQFFSARWIPEPDSDEAVDILRAWLCEPLLVPAARLCRVLDIRHSTSASPPLSSGSVCYFRSWTLLA… |
| A0A1X2H9P6 | 7-217 | INQVVFQTIRDRFQYHENTEADFDNNSTRFLLREDIEGSAENLERVRSIMEAHTRLSDEQLQEVLNLRPATEEGITESTWTLYVRSW… |
| A0A0E9NQV4 | 130-409 | None |
| A0A1J7IND5 | 11-272 | None |
| A0A077WXA7 | 1-205 | None |
| A0A077WWR1 | 4-205 | None |
| A0A168JG01 | 10-244 | None |
| A0A395H565 | 30-240 | None |
| J6EYI6 | 5-236 | None |
| A0A1L9TJZ2 | 35-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.