DPCstruct | MC28305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 353 ± 87 aa |
| Standard deviation of domain lengths | 86.83 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 75.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 18.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2H3S6 | 8-337 | HILYNLEERTQDCFKQAAARLREGCRSLLVSNHDKMAYALELTLCEVATAKIAIPTVCAQFTELDKHERPSDYNNIVQQCITLLAAV… |
| A0A1Y1V9C4 | 44-279 | IYNRAINSFNKYTSKEDCFQNSIKTLKYGCLEMELDDNKKMEYAVELTLCELTSANISIPTECQNNYKTRNMAKCVETISRYNQLWT… |
| A0A7D9H0N0 | 40-325 | None |
| A0A2N6NDB6 | 58-351 | None |
| A0A0D7BK06 | 3-409 | None |
| A0A1C7MPN9 | 21-433 | None |
| A0A6A5WM03 | 56-468 | None |
| Q6C994 | 16-405 | None |
| R9ACR0 | 5-234 | None |
| J3KIY5 | 6-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.