DPCstruct | MC2830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 6.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0JT72 | 2-50 | IRCPNCGSHGERHYLQKQNVVQTQCPSCDYLMVNCIQTGSVVEAYAPGI |
| A0A654SFB3 | 1-76 | MQRAQIIRCPNCGGQAQRQFLTDRKLADRHCLVNQIIRTECRFCDYLMVMRCLDGSVIEAYAPGIKSSFRPSTTSD |
| A0A1Z4RTY8 | 15-72 | None |
| A0YR28 | 9-65 | None |
| A0A846DDT9 | 1-69 | None |
| A0A845WW93 | 10-66 | None |
| A0A350YBH6 | 1-58 | None |
| L8M3P4 | 1-62 | None |
| K9U8A5 | 1-63 | None |
| U9VVW9 | 8-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.