DPCstruct | MC283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 169 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14972 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7MPS0 | 1-143 | MELERALEAGIHTIVIEPTTLGDETARWIAVGNCLHKTAVLAGFGSIVSGLIWRDTAYVCVPLGTLSLFCTGVYTASWQFDPCCKYQ… |
| A0A0V1I186 | 458-615 | DIVVIDDAYLRENGYAVAELEKALMEKCSYIIIESTVLANQAKGSISIGNFLHRTAVLLGSATMIIICYFPNLPIVWGTTYGTSVVS… |
| A0A4Y7M451 | 73-237 | None |
| A0A1D2NF58 | 30-188 | None |
| T1EQU3 | 20-191 | None |
| A0A310SNV0 | 214-376 | None |
| A0A369SBV5 | 37-236 | None |
| A0A402F6K4 | 195-378 | None |
| A0A670KKX7 | 67-220 | None |
| A0A6B2G6T9 | 2-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.