DPCstruct | MC28291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 182 ± 18 aa |
| Standard deviation of domain lengths | 17.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9IAK4 | 721-899 | EPELFDPEKWTSNYPNPAFLSRQPDDEYWAAKQVMAFTDEDIRAIVETGQYSDPKAAEYIASALAIRRDKIGRTYFSKILPLDHFAV… |
| A0A2E3YFB6 | 1-163 | MDHPWVAFWGARIVTAFSDDHIGAAVSSGQFNDAAADSHLVRFLIERRDRVGQHWFNRLNSLDRFRVEGGALRFDDLAVAGGYRGDI… |
| A0A538QKK9 | 1-201 | None |
| A0A539D9P6 | 30-216 | None |
| A0A2M6ZQF3 | 359-556 | None |
| A0A843SNU8 | 184-376 | None |
| A0A4Y8ICU2 | 2-143 | None |
| A0A2H0P4K3 | 156-344 | None |
| A0A523ELK8 | 352-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.