DPCstruct | MC28290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 103 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4ZXE8 | 160-265 | KGIEYQKPPYSTRWPELANILDGDPYAPEGNVVARNVCSGGRWDEFEAKALPLIHFENNLLDEDPRFVDLEAGDFQLRDDSPAYKLG… |
| A0A2E3YCA8 | 9-110 | RMPVASPIWAQRYPELLTIWEEEAAAPKGNIIRRNVCQGGVWDGLREDARSYVELSANLVADDVGLEGTAPRFGLRADSLAHSIGFQ… |
| A0A7X3ZDH3 | 123-215 | None |
| A0A7X6ZFN1 | 190-285 | None |
| A0A7V4TA43 | 70-178 | None |
| A0A7X7AYH7 | 1090-1187 | None |
| A0A7V7D7U5 | 599-712 | None |
| A0A7Y4VCI9 | 2-102 | None |
| A0A2M7KS15 | 54-164 | None |
| A0A832FVH0 | 5-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.