DPCstruct | MC2829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 9.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6UG81 | 415-528 | FSFDVDESLQAQALTDGLLVIRHLFGFSGVSLTSGALSDDAGRDSPEAIADYLTEADPQLDIDGDGLSQPLTDGLLLIRYLFGFSGE… |
| A0A654SF36 | 115-237 | PIAVTPWNLDIDGNGEIKALSDGIIAIRYMFGSSFSGEKLIDGAIASDATRNLAEIQEYLQQGLHQGYLDIDGNGETKALSDGIIAI… |
| A0A2D4SL45 | 24-155 | None |
| Q1YTS7 | 2-90 | None |
| Q1YPD5 | 4-114 | None |
| A0A1V5FNV9 | 87-227 | None |
| A0A2D7FW05 | 835-946 | None |
| A0A351CZE8 | 19-143 | None |
| A0A2E0EUI5 | 184-310 | None |
| A0A381TST6 | 20-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.