DPCstruct | MC28287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 141 ± 22 aa |
| Standard deviation of domain lengths | 22.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5DSK6 | 10-140 | QIIDEIRAHFERPVHEPARWNVPSLAGDERRQVSVVASRERGHDLGPGQSWASGLHLSFLARVDGEPADMLDDDLTGWARAILGGYL… |
| A0A1Z1UXH5 | 59-202 | RAVLAARIRQTHLPMLPSFISGAASDIVSTVVAESLATENVTLTVTITSRRFDVGPRRSDPAASGIVVTVTVASTDTESGARRHVPM… |
| A0A2S8ZAN6 | 1-121 | None |
| A0A2S8J3M3 | 19-141 | None |
| A0A1D9FDG7 | 2-103 | None |
| A0A0D0IQ60 | 8-150 | None |
| A0A6G7XI59 | 23-131 | None |
| A0A1X1BDJ3 | 3-167 | None |
| A0A143Q5V5 | 8-137 | None |
| R7WRC2 | 17-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.