DPCstruct | MC28286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 11.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7U574 | 5-100 | QAVRDALAHVSFQNWTFHVDHEEGTTFIRVRFLVDGAEQHGRKWFVSPDATPSDIVRTAFMAVMTAVEHEAREHFAYKGWAIFGPHY… |
| A0A7J5DQK2 | 19-124 | FEEVQHDITFKPGYRLLLKPSTEEMGTRWYFQVESQRRDAVTGEMGTGRGGKRFLSPHACRSELTQTALALFLAYEEHEVREHFRYR… |
| A0A2T5J473 | 41-134 | None |
| A0A2T5J412 | 2-131 | None |
| A0A2R7SD55 | 6-117 | None |
| A0A3N8Y6M5 | 18-124 | None |
| A0A2G2J3L1 | 16-138 | None |
| A0A3S0BE71 | 15-105 | None |
| A0A1X0A0C4 | 2-91 | None |
| A0A5C8Z8P0 | 48-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.