DPCstruct | MC28284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 259 ± 26 aa |
| Standard deviation of domain lengths | 25.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y3MYZ2 | 72-319 | LSATGAIPEVFRTGGVTGPLIGETFASSTLLLQSLAALGVAVLLCWGANLPWTRSSAAAALLGGLVLVPGVAAAGALSVGEHERYRA… |
| A0A5S4GL68 | 21-241 | FPRIDLFTTLRPRVFADQVAWTAGLTAALILGYVLWATRRFLLVLPLAAALAATGTATLGLHDSGGAAVRTADAEPVCREWPLVVCV… |
| A0A7K0PPB0 | 2-243 | None |
| A0A433FAT6 | 128-448 | None |
| A0A7M1R1G0 | 147-425 | None |
| A0A4Y4DTF5 | 185-432 | None |
| A0A4Y3MZY4 | 145-405 | None |
| A0A7X0P449 | 165-427 | None |
| A0A0Q8Q5I6 | 2-217 | None |
| A0A423UG39 | 104-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.