DPCstruct | MC28280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A075V4F2 | 69-207 | SYIAANSWATAWAGATAYAAEFTVRPAPGNGFLYRAVSGGTSGASAPTWPTVVGGTVTDGSVVWECVGSGATQFTASNPAWASATFT… |
| A0A1W9LK13 | 53-205 | AYIQKIMQNIMAAFNYNGNPKWSANTTYSVNDIVIPISRNGHSYKCKTAGTSGASEPVWKTGIGNDTPEASPLIWTDNGPPLAVTVL… |
| A0A7V5R5W8 | 28-146 | None |
| A0A7V3AG55 | 258-359 | None |
| A0A0F9MPC9 | 1-130 | None |
| A0A0F9MMY9 | 5-144 | None |
| A0A5C7PKZ7 | 288-388 | None |
| A0A0B0HZS4 | 182-303 | None |
| X1QTY5 | 80-167 | None |
| A0A2V9DF01 | 509-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.