DPCstruct | MC2828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 8.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6MXY7 | 1-98 | MAIMGKYCKAYSIKVLRQFGQWTENSENTKKEKQQIDGKEIELPRVLTDDDFLYLQDNYIVTDGIFKDENIIFENVTPEWKTFCQKN… |
| A0A5C2D066 | 1-96 | MNRLGKYCKAYMLEDLRKFSGWNESAREAEVHGANGDADAAGETDLSNILFVQENYTVTGGIFLDENVVLDRPTQEWIEFCRDTLRF… |
| A0A7I8EVM9 | 1-88 | None |
| A0A652LU62 | 47-127 | None |
| K0K5P4 | 4-83 | None |
| A0A178WQR1 | 105-176 | None |
| A0A3M2C4U6 | 4-103 | None |
| A0A1R0KHA3 | 1-80 | None |
| A0A2W2ENY9 | 162-235 | None |
| A0A455SH90 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.