DPCstruct | MC28279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3SV03 | 176-282 | GMHEGYAEGEGETLPPHSADQNKDWEINLIELLRVIQLYNSGGYHCDALGEDGYAPGPGEVNCSPHSSDCNPQDWKINLPELLRIIQ… |
| A0A7C1GQP4 | 437-544 | GLVPTLLAELLSEVYAHSADTDGDWRISLRELLRVIQLYNSGQYHVDPAGEDGYGIGEGPVDGLNHSADYIGDWRITLPELLRVIQL… |
| A0A7C3WTF1 | 827-950 | None |
| A0A7C4UQK3 | 814-951 | None |
| A0A7C4UUI3 | 793-916 | None |
| A0A7C4YS91 | 968-1098 | None |
| A0A1W9N1H3 | 60-171 | None |
| A0A7C4Z1A0 | 838-954 | None |
| A0A847G9G4 | 443-557 | None |
| A0A1G2QM54 | 89-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.