DPCstruct | MC28275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 117 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1CLI4 | 2-121 | YIRFQSLEESPYTGEKYGIFVAVWHLIRDKKVTHEEEAEYWKHRAWFENNLPIPPFYEAGNQEKAITWFKTDALTVEMKKHLLFYFE… |
| A0A081N6I9 | 4-76 | SWFQKSLLTPNIFEDSKNLLGVCWFKNAQVEIINKVRELVPVLETCGLEVSEMRSDSPGTVIYEDSQQVVAVP |
| A0A151BXE0 | 2-134 | None |
| A0A7X4RUE9 | 18-139 | None |
| A0A4R6PQE4 | 64-188 | None |
| A0A1H5Z7K2 | 12-147 | None |
| S3AY24 | 45-175 | None |
| A0A2P9IGQ2 | 1-111 | None |
| A0A1G8TN08 | 3-121 | None |
| A0A4T0V4H6 | 6-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.