DPCstruct | MC28274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 257 ± 37 aa |
| Standard deviation of domain lengths | 37.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.46 |
| Pfam Score | 97.23 |
| Assigned Pfam label(s) | PF13018- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378BJR1 | 3-153 | DPQAYTHSSGATVIDIEKPNAAGVSHNLYRDFNVGTNGTILNNSGDDVSHSTFGNIARNNNLTAGSASVILNEVTSKNASSLKGFIE… |
| A0A8A8C1J6 | 4-238 | KKLPSLNLLVISISFAFMHNSAVANNVIVDAGKSANTTVSKNGDGSETISINKANDMNLSVNYFEQFNVGKEGVHIDNSEVKAKVIL… |
| A0A120GBP2 | 4-305 | None |
| A0A166VH15 | 7-215 | None |
| A0A168S2P3 | 2-286 | None |
| J5AQF1 | 18-282 | None |
| A0A158JG56 | 1-275 | None |
| A0A352APM0 | 25-316 | None |
| A0A3M2HTU9 | 23-229 | None |
| A0A653JVM3 | 22-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.