DPCstruct | MC28270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 226 ± 47 aa |
| Standard deviation of domain lengths | 47.19 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7F047 | 3-208 | LPEKAFRHAGYLEDLVNHHQELSNVTLVDPISDGSGQIIPVEPPAEKEVEQPLVREVEVPLTFDAEFFGLLQGDVHNLDALQDEEQK… |
| A0A0C3L8X9 | 5-159 | QDEVVYPLSSDAAFLELLSGALAALATLYSSILRHCDVEIEALSRTISSTARPRSEGGKSDLDTWRSIFQLWVESEIFESLSERHHG… |
| A0A1X2GKH9 | 2-160 | None |
| A0A0F7SJC1 | 515-724 | None |
| A0A1Y1WJK9 | 129-339 | None |
| A0A842Z9J6 | 1-148 | None |
| A0A1Y1VD79 | 268-470 | None |
| K5UYJ5 | 1-193 | None |
| J5TKZ0 | 287-502 | None |
| M1VZA3 | 1-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.