DPCstruct | MC2827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 200 ± 21 aa |
| Standard deviation of domain lengths | 21.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1NXB3 | 10-201 | TARFMLMLSRYKDLNLDFVHKRVKIIDTLDYSLYNTYIELVKASFKGFYDVLDKIAYFINDYLRLGIPDRRVSFRAVWYQSSRDKTI… |
| A0A181C8S3 | 14-209 | GVTLTNTLDYPLYSLASERVRTAFRIAYSLLDKIAFLIDRYWKLGKIPAHISFKNVWMVEKKQRLLPQFAESNNWSLRGLYWLSKEL… |
| A0A7H8PP50 | 1-163 | None |
| A0A8B3R840 | 4-198 | None |
| A0A7H9DQN8 | 11-223 | None |
| A0A4Q2Y2W9 | 47-257 | None |
| R6PPR2 | 28-206 | None |
| A0A497RLU1 | 72-296 | None |
| A0A3S0E3E0 | 264-488 | None |
| A0A5M8GHM7 | 2-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.