DPCstruct | MC28269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5SBI9 | 4-116 | GHVVVIDHSAMACFGAFDPDICGLVTIGDDTTSICGHIGCSRGIPVLGITDGDIDGIVPEGYAPGSVILQVVRERDDELGIEIAEKV… |
| A0A7J4KGW8 | 36-154 | LATGRVLFLDHCGHQIYTRLTPGICGIVSVGDDTTAVCGHIAAHLGIPVFGIIDGDEDGIVEGSFVPGSVIARAVHERDDDIGDEIG… |
| A0A497KJN8 | 244-358 | None |
| A0A7J3P0E4 | 124-241 | None |
| A0A424YY85 | 176-298 | None |
| A0A662RYB8 | 273-409 | None |
| A0A832U3X8 | 24-136 | None |
| A0A523AUF7 | 79-192 | None |
| A0A1V5YH56 | 2-98 | None |
| A0A2V2N5Z3 | 187-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.