DPCstruct | MC28268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 9.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6LPA5 | 1-115 | MLKQLLEHVLQTDITVDGHTFPLAAIIWHKRIPEFEFDFPVSAFFPDMLNGLSDDRTSVVVRRFHEQGSSELEGIMNGKMDLFFEHE… |
| A0A3S3SJU3 | 10-127 | GFDQSWLPMVGSWMGDILQTNLGKENAFSLAAVRENNRVNEMAFYFPLIGMRLRRFNQVLEAFSYPPLPNQHEVLEGLMVGFIDLVF… |
| A0A800LRL4 | 290-402 | None |
| A0A378AJ24 | 252-361 | None |
| A0A258R029 | 278-391 | None |
| A0A378MXF1 | 66-185 | None |
| A0A377CXQ3 | 23-142 | None |
| A0A7X9HDV1 | 75-190 | None |
| A0A3B8Z1A6 | 910-1015 | None |
| A0A3R8MVQ8 | 354-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.