DPCstruct | MC28266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 559 ± 45 aa |
| Standard deviation of domain lengths | 44.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X4Y423 | 14-600 | AIAFDALWQQAHEKVTALSGEIWTDTGDHDPGVTLLQSATWNCSDLSYRASLSLNDLLTHQDRNTLFPEEFGPEQVLTCNTVTAEDY… |
| A0A5C6LM07 | 12-519 | KERDNTLDFARLRAEALTLVQELSGHVWTDYNLHDPGVTILEQLCFALTDLAYKTDFPINEILADKEGRISARHNVFFSKSDILNSG… |
| A0A839LMC9 | 11-525 | None |
| A0A3P1C3T1 | 2-639 | None |
| A0A2S2CZL0 | 23-565 | None |
| A0A6P0VI65 | 17-556 | None |
| G7G2R2 | 18-629 | None |
| A0A7Y7HX72 | 21-576 | None |
| A0A7V9M2S3 | 1-585 | None |
| A0A2W4T967 | 5-598 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.