DPCstruct | MC28264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 57.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376TFA5 | 28-96 | ALSSMANIAGYRAIVEAAHEFGRFFTGQITAAGKVPPAKVMVIGAGVAGLAAIGAANSLGAIVRAFDTR |
| A0A839G3J9 | 1-68 | MEALSSTADIADYRAVVGAAHMFGRFFTGQVTAAGKFPPAKVLIAGAGVSAIGAASSLGAIVRTTDPE |
| A0A401SJS3 | 115-189 | None |
| A0A7J6R3D0 | 229-294 | None |
| I7ML24 | 761-835 | None |
| A0A6G3VPL6 | 1-77 | None |
| A0A820RWS4 | 195-254 | None |
| A0A0D8XAP4 | 168-236 | None |
| A0A5J4WXU1 | 98-165 | None |
| A0A1Y1KBT1 | 197-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.