DPCstruct | MC2826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 705 |
|---|---|
| Mean domain length (aa) | 192 ± 32 aa |
| Standard deviation of domain lengths | 31.59 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.56 |
| Pfam Score | 96.69 |
| Assigned Pfam label(s) | CL0276- CL0161- CL0681- CL0304- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316S665 | 4-174 | IDEMKTLLQEALPPKRFKHSLGVYETALKMAEHYGMEKEKIAIASLLHDCGREVPTDQQVAKAEELGLEVDYVERRQPILLHAKLGA… |
| A0A2M7NZU6 | 314-508 | IENKRLITVIKTNLINITRSLAEAIEAKDSHTRGHCERTAWYAVATARELNMPKAVIETIEIATLLHDIGKIGIPENILLKPGGLTQ… |
| A0A2Z3JL60 | 24-163 | None |
| A0A6J4JMV1 | 143-354 | None |
| A0A4Q3K1N6 | 149-317 | None |
| A0A7V9SGP9 | 159-322 | None |
| A0A6L9ITR0 | 446-700 | None |
| A0A0S7ZRW7 | 37-208 | None |
| A0A7X7KUF6 | 387-642 | None |
| A0A511N404 | 15-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.