DPCstruct | MC28259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 4 aa |
| Standard deviation of domain lengths | 4.34 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y6CDG6 | 248-341 | VTAKGRFFGIENNGIVCITTPCFSYDAAMLNKNSEKSLSRVNFESSGADKDKVELANQLLANGEVLNASGRFKSYDGFSGKGLEFVV… |
| A0A519ZI21 | 140-226 | PTGLFYGLKSSGIVCITYPCPTITETTLNFPAKRNIAGLNLSSAGATPEQVEAGNQALFGSGLLAAGVHKTISGPAGQGQQLVASEF |
| A0A4Q6DZZ3 | 28-122 | None |
| A0A661P2T2 | 145-228 | None |
| A0A538QAK8 | 99-194 | None |
| A0A7V9L1T6 | 156-253 | None |
| A0A1L9BGZ5 | 1-97 | None |
| A0A849ZAA4 | 83-174 | None |
| A0A538G7G6 | 49-145 | None |
| A0A849U9F5 | 124-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.