DPCstruct | MC28255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 160 ± 26 aa |
| Standard deviation of domain lengths | 25.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8GQ04 | 9-193 | QPSSDQDPFAPVPVDLKNPSTAILLAWLIPGAGHLYQGRRGKGILFLVCILSIYFLGLSMGGGRVVYAKWDNTEKRLPLLCQLGVGL… |
| A0A136KBX6 | 3-126 | KPILLIIAAWFIPGAGYFLQGKVVRAVVIGVVVWCLFILAIVNGGAYYPGFSYQDGQLLYLLNFVSRIGNGLGGFVSYFMAAQPDKH… |
| A0A3L7N8B5 | 84-277 | None |
| A0A1G3AHA9 | 2-161 | None |
| A0A0S7YT01 | 3-149 | None |
| A0A661U9Y0 | 16-139 | None |
| A0A1F7RXR7 | 17-156 | None |
| A0A354PH47 | 74-270 | None |
| A0A2D6HEB4 | 115-245 | None |
| A0A2D9C7F0 | 57-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.