DPCstruct | MC28253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 433 ± 71 aa |
| Standard deviation of domain lengths | 71.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 31.45 |
| Pfam Score | 40.91 |
| Assigned Pfam label(s) | CL0020- CL0465- PF06985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9R7I6 | 130-678 | RMIYAQARRVIVWLGEVLEDSDNALEVISHLGREQNILSCERIEKENHDACQRLLQRNWFGRIWVLQEVGVAQCISVMYGSVQINGH… |
| A0A5N6T3A6 | 69-512 | RRASCLHDKVYALLGMCSDDSNTEALRPDYQLPWNTVFERVIKHIISPDISVQTWPDREAAVIRGKGYMLGLIKSVTTPGSRYDRQE… |
| A0A384JII6 | 145-526 | None |
| A0A0F0I6C7 | 100-563 | None |
| A0A1S8A550 | 116-672 | None |
| A0A401L1W7 | 36-463 | None |
| A0A317XDT2 | 132-709 | None |
| A0A084B5Y1 | 338-702 | None |
| A0A2P4ZMV6 | 78-640 | None |
| A0A1M3TCI2 | 99-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.