DPCstruct | MC2825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07372 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379N8U8 | 1-82 | MVLRKGDPDSGGILCVLHGREGMVVLSQVRDAEGRQAWMRGTGATAVNQETADAYVARQVKRDPDLWVLEFEAPDLLPPFEA |
| A0A3C1BQG5 | 64-156 | VQALVRRVNSECIGVIARRGDTDAGGIYVRVNRLDGRSGLLVAFTDMNGERRWRVLASHLTPDDQIEDMLVREIARDPDMWVVEIED… |
| A0A2A2KGC2 | 1-75 | None |
| A0A1E3H8C1 | 167-267 | None |
| A0A3B0TN26 | 2-105 | None |
| H6SNS0 | 194-289 | None |
| X5MMS4 | 8-96 | None |
| A0A2W5MZ69 | 23-122 | None |
| A0A845QA83 | 1-113 | None |
| E0TH79 | 2-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.